Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d021370_circ_g.6 |
ID in PlantcircBase | zma_circ_009407 |
Alias | zma_circ_0002593, GRMZM5G818058_C4 |
Organism | Zea mays |
Position | chr7: 150112133-150112559 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d021370 |
Parent gene annotation |
Protein CURVATURE THYLAKOID 1B chloroplastic |
Parent gene strand | + |
Alternative splicing | Zm00001d021370_circ_g.1 Zm00001d021370_circ_g.2 Zm00001d021370_circ_g.3 Zm00001d021370_circ_g.4 Zm00001d021370_circ_g.5 Zm00001d021370_circ_g.7 Zm00001d021370_circ_g.8 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d021370_T001:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.155326795 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
150112410-150112410(-) |
Potential amino acid sequence |
MAPTTVQSATMAATPMVATAYLSSTLSHASCAAFTISGTSSVAPSPPDVALTATPLGILEPLYT QFQQSQGHQAEEEACRWPELAGKENP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |