Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d021370_circ_g.6 |
| ID in PlantcircBase | zma_circ_009407 |
| Alias | zma_circ_0002593, GRMZM5G818058_C4 |
| Organism | Zea mays |
| Position | chr7: 150112133-150112559 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d021370 |
| Parent gene annotation |
Protein CURVATURE THYLAKOID 1B chloroplastic |
| Parent gene strand | + |
| Alternative splicing | Zm00001d021370_circ_g.1 Zm00001d021370_circ_g.2 Zm00001d021370_circ_g.3 Zm00001d021370_circ_g.4 Zm00001d021370_circ_g.5 Zm00001d021370_circ_g.7 Zm00001d021370_circ_g.8 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d021370_T001:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.155326795 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
150112410-150112410(-) |
| Potential amino acid sequence |
MAPTTVQSATMAATPMVATAYLSSTLSHASCAAFTISGTSSVAPSPPDVALTATPLGILEPLYT QFQQSQGHQAEEEACRWPELAGKENP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |