Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0885600_circ_g.1 |
ID in PlantcircBase | osa_circ_005123 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 38477560-38478008 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os01g0885600 |
Parent gene annotation |
Alpha/beta hydrolase fold-1 domain containing protein. (Os01t088 5600-01) |
Parent gene strand | + |
Alternative splicing | Os01g0885600_circ_g.2 Os01g0885600_circ_g.3 Os01g0885600_circ_g.4 Os01g0885600_circ_g.5 |
Support reads | 2 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0885600-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.18438428 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
38477730-38478005(+) 38477728-38477729(-) |
Potential amino acid sequence |
MDKSVPDPPTAVLLHGILGSRKNWGSFAKRLAQEFPMWQAYELVQGSLVQWNSFMDKSVPDPPT AVLLHGILGSRKNWGSFAKRLAQEFPMWQAYELVQGSLVQWNSFMDKSVPDPPTAVLLHGILGS RKNWGSFAKRLAQEFPMWQAYELVQGSLVQWNSFMDKSVPDPPTAVLLHGILGSRKNWGSFAKR LAQEFPMWQ(+) MSSIAQGSLEPAHRPATSEIPEPASLQKIPSFSCSQGCHEGEQLLVDQVLICP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |