Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0885600_circ_g.1 |
| ID in PlantcircBase | osa_circ_005123 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 38477560-38478008 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0885600 |
| Parent gene annotation |
Alpha/beta hydrolase fold-1 domain containing protein. (Os01t088 5600-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0885600_circ_g.2 Os01g0885600_circ_g.3 Os01g0885600_circ_g.4 Os01g0885600_circ_g.5 |
| Support reads | 2 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0885600-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.18438428 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
38477730-38478005(+) 38477728-38477729(-) |
| Potential amino acid sequence |
MDKSVPDPPTAVLLHGILGSRKNWGSFAKRLAQEFPMWQAYELVQGSLVQWNSFMDKSVPDPPT AVLLHGILGSRKNWGSFAKRLAQEFPMWQAYELVQGSLVQWNSFMDKSVPDPPTAVLLHGILGS RKNWGSFAKRLAQEFPMWQAYELVQGSLVQWNSFMDKSVPDPPTAVLLHGILGSRKNWGSFAKR LAQEFPMWQ(+) MSSIAQGSLEPAHRPATSEIPEPASLQKIPSFSCSQGCHEGEQLLVDQVLICP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |