Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0885600_circ_g.4 |
ID in PlantcircBase | osa_circ_005126 |
Alias | Os_ciR6321 |
Organism | Oryza sativa |
Position | chr1: 38477711-38478191 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, PcircRNA_finder, circRNA_finder, circseq_cup, find_circ |
Parent gene | Os01g0885600 |
Parent gene annotation |
Alpha/beta hydrolase fold-1 domain containing protein. (Os01t088 5600-01) |
Parent gene strand | + |
Alternative splicing | Os01g0885600_circ_g.1 Os01g0885600_circ_g.2 Os01g0885600_circ_g.3 Os01g0885600_circ_g.5 |
Support reads | 2/3/4 |
Tissues | root/root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0885600-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011024 |
PMCS | 0.42903902 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
38477730-38478188(+) 38477728-38478138(-) |
Potential amino acid sequence |
MDKSVPDPPTAVLLHGILGSRKNWGSFAKRLAQEFPMWQFLLVDLRCHGDSASIKKRGPHTVAS TALDVLKLVQWNSFMDKSVPDPPTAVLLHGILGSRKNWGSFAKRLAQEFPMWQFLLVDLRCHGD SASIKKRGPHTVASTALDVLKLVQWNSFMDKSVPDPPTAVLLHGILGSRKNWGSFAKRLAQEFP MWQFLLVDLRCHGDSASIKKRGPHTVASTALDVLKLVQWNSFMDKSVPDPPTAVLLHGILGSRK NWGSFAKRLAQEFPMWQFLLVDLRCHGDSASIKKRGPHTVASTALDVLKL(+) MSSIAPALEHQEQLRQQYAVLFS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |