Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0885600_circ_g.4 |
| ID in PlantcircBase | osa_circ_005126 |
| Alias | Os_ciR6321 |
| Organism | Oryza sativa |
| Position | chr1: 38477711-38478191 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, PcircRNA_finder, circRNA_finder, circseq_cup, find_circ |
| Parent gene | Os01g0885600 |
| Parent gene annotation |
Alpha/beta hydrolase fold-1 domain containing protein. (Os01t088 5600-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0885600_circ_g.1 Os01g0885600_circ_g.2 Os01g0885600_circ_g.3 Os01g0885600_circ_g.5 |
| Support reads | 2/3/4 |
| Tissues | root/root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0885600-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011024 |
| PMCS | 0.42903902 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
38477730-38478188(+) 38477728-38478138(-) |
| Potential amino acid sequence |
MDKSVPDPPTAVLLHGILGSRKNWGSFAKRLAQEFPMWQFLLVDLRCHGDSASIKKRGPHTVAS TALDVLKLVQWNSFMDKSVPDPPTAVLLHGILGSRKNWGSFAKRLAQEFPMWQFLLVDLRCHGD SASIKKRGPHTVASTALDVLKLVQWNSFMDKSVPDPPTAVLLHGILGSRKNWGSFAKRLAQEFP MWQFLLVDLRCHGDSASIKKRGPHTVASTALDVLKLVQWNSFMDKSVPDPPTAVLLHGILGSRK NWGSFAKRLAQEFPMWQFLLVDLRCHGDSASIKKRGPHTVASTALDVLKL(+) MSSIAPALEHQEQLRQQYAVLFS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |