Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0805600_circ_g.3 |
| ID in PlantcircBase | osa_circ_017037 |
| Alias | Os_ciR8188 |
| Organism | Oryza sativa |
| Position | chr2: 34368506-34368794 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0805600 |
| Parent gene annotation |
Similar to Alcohol dehydrogenase, zinc-containing. (Os02t0805600 -01);Similar to Alcohol dehydrogenase, zinc-containing. (Os02t08 05600-02) |
| Parent gene strand | + |
| Alternative splicing | Os02g0805600_circ_g.2 Os02g0805600_circ_g.4 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0805600-01:2 Os02t0805600-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.290662082 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34368787-34368567(+) 34368538-34368744(-) 34368740-34368703(-) |
| Potential amino acid sequence |
MERIHGGSSGIGTFAIQIAKHLGIKVFVTAGSEEKLAACKGLGADVCINYKTEDFVARVKEETN GKDPWWIEWNWYICYTDCKAPWN*(+) MYQFHSIHHGSFPFVSSLTRATKSSVL*(-) MHTSAPKPLQAASFSSLPAVTKTLIPRCFAICIANVPIPLDPPWILSICFFFDTCNEIFSFVVY AYIGTQTFAGS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |