Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA026439_circ_g.6 |
ID in PlantcircBase | osi_circ_007454 |
Alias | 7:27536523|27537224 |
Organism | Oryza sativa ssp. indica |
Position | chr7: 27536523-27537224 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA026439 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA026439_circ_g.2 BGIOSGA026439_circ_g.3 BGIOSGA026439_circ_g.4 BGIOSGA026439_circ_g.5 BGIOSGA026439_circ_igg.1 BGIOSGA026439_circ_igg.2 BGIOSGA026439_circ_igg.3 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA026439-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_035436* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27536845-27536527(+) |
Potential amino acid sequence |
MPANCLSRAHGVIEMPVSPPESLIFEPFIETDEIIISTKSVDDSTRHLVWKGENKWLEVTVGVV GKRGEMLSLNPSITVKESGDILSLEEKFQAG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |