Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0691200_circ_g.6 |
| ID in PlantcircBase | osa_circ_035436 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 29399746-29400447 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0691200 |
| Parent gene annotation |
Similar to D-alanine--D-alanine ligase B (EC 6.3.2.4) (D-alanyla lanine synthetase B) (D-Ala-D-Ala ligase B). (Os07t0691200-01);S imilar to D-alanine--D-alanine ligase family. (Os07t0691200-02); Similar to predicted protein. (Os07t0691200-03);Hypothetical con served gene. (Os07t0691200-04) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0691200-01:3 Os07t0691200-02:3 Os07t0691200-04:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007454* osi_circ_017522 |
| PMCS | 0.189252754 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29400068-29399750(+) |
| Potential amino acid sequence |
MPANCLSRAHGVIEMPVSPPESLIFEPFIETDEIIISTKSVDDSTRHLVWKGENKWLEVTVGVV GKRGEMLSLNPSITVKESGDILSLEEKFQAG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |