Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0691200_circ_g.6 |
ID in PlantcircBase | osa_circ_035436 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 29399746-29400447 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0691200 |
Parent gene annotation |
Similar to D-alanine--D-alanine ligase B (EC 6.3.2.4) (D-alanyla lanine synthetase B) (D-Ala-D-Ala ligase B). (Os07t0691200-01);S imilar to D-alanine--D-alanine ligase family. (Os07t0691200-02); Similar to predicted protein. (Os07t0691200-03);Hypothetical con served gene. (Os07t0691200-04) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0691200-01:3 Os07t0691200-02:3 Os07t0691200-04:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007454* osi_circ_017522 |
PMCS | 0.189252754 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29400068-29399750(+) |
Potential amino acid sequence |
MPANCLSRAHGVIEMPVSPPESLIFEPFIETDEIIISTKSVDDSTRHLVWKGENKWLEVTVGVV GKRGEMLSLNPSITVKESGDILSLEEKFQAG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |