Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA006669_circ_g.2 |
ID in PlantcircBase | osi_circ_003832 |
Alias | 2:11772853|11774301 |
Organism | Oryza sativa ssp. indica |
Position | chr2: 11772853-11774301 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA006669 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA006669_circ_g.1 BGIOSGA006669_circ_g.3 BGIOSGA006669_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA006669-TA:5 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_003194 |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11774172-11773029(+) |
Potential amino acid sequence |
MFRPLQNHTAQAIGYHGRLQFEAANRQHMLPEIVHKGKNGHPFHSSIFSSIKQFNPVLVISAPL CCKILSFPSLVP*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |