Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0571300_circ_g.1 |
ID in PlantcircBase | osa_circ_008099 |
Alias | Os_ciR6913 |
Organism | Oryza sativa |
Position | chr10: 22651207-22652717 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os10g0571300 |
Parent gene annotation |
Similar to Protein kinase-like protein. (Os10t0571300-01) |
Parent gene strand | + |
Alternative splicing | Os10g0571300_circ_g.2 Os10g0571300_circ_g.3 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os10t0571300-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008730 |
PMCS | 0.183230863 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22651234-22651239(+) 22651229-22652567(-) |
Potential amino acid sequence |
MRLRVAYYIAQALDHCNAENRKIYHDLNAYRVLFDEEGDPRLSSFGLMKNSRDGKSYSTNLAYT PPEFLRTGRVIAESVIYSYGTVLLDLLSGKHIPPSHALDLIRGKNILLLMDSSLEGQYANEDAS KLVDLASKCLQFEARDRPNIKYLLSSVGPLQKQKEVASHVLMGITKATAVLPTILSPLGKACSG MDLTAVHDILLKTGYKDEEGAENEGISSPCHGKCG*(+) MARAAYPLIFCTFFIFVTCFEQYIMYCCKVHTGTGLPKGRKNSWQHRRGFCNTHQHM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |