Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0297600_circ_g.2 |
| ID in PlantcircBase | osa_circ_014354 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 11400373-11401677 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0297600 |
| Parent gene annotation |
Protein of unknown function DUF707 family protein. (Os02t0297600 -01);Protein of unknown function DUF707 family protein. (Os02t02 97600-02) |
| Parent gene strand | + |
| Alternative splicing | Os02g0297600_circ_g.1 Os02g0297600_circ_g.3 Os02g0297600_circ_g.4 Os02g0297600_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0297600-02:5 Os02t0297600-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.115326162 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11400443-11400405(+) 11401662-11400673(+) 11400443-11400971(-) |
| Potential amino acid sequence |
MAKPANSIGRSTPRSNEGMRLIFSAVVGVMLGYLFGVSFPTVNITKLHFPSSIISYIEDRNSGI TTQTLLNHAWASANRHNKNNSDSTSEEVPKIYVPTNPKGAERLPPGIVVSETDLFPRRLWGDPS EDLSSEPRYLVTFTVGITQKANIDAAVKKLQLYRFLRQQL*(+) MLLSKSCSSTGFFGSNCSRKERGEDSQFIWQNLLIALAVARQDQMRG*(+) MNCESSPLSFLLQLLPKKPVELQLFDSSINISLLCNSNCKSNKVPWFATQVLTRITPQSPWKKI CFRNNNAWWEPFSTFRVCGNINLRNFFRG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |