Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0297600_circ_g.1 |
ID in PlantcircBase | osa_circ_014353 |
Alias | Os_ciR4638 |
Organism | Oryza sativa |
Position | chr2: 11400373-11400992 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0297600 |
Parent gene annotation |
Protein of unknown function DUF707 family protein. (Os02t0297600 -01);Protein of unknown function DUF707 family protein. (Os02t02 97600-02) |
Parent gene strand | + |
Alternative splicing | Os02g0297600_circ_g.2 Os02g0297600_circ_g.3 Os02g0297600_circ_g.4 Os02g0297600_circ_g.5 |
Support reads | 4/3 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0297600-01:3 Os02t0297600-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.326175995 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11400443-11400405(+) 11400926-11400673(+) 11400443-11400971(-) |
Potential amino acid sequence |
MAKPANSIGRSTPRSNEGMRLIFSAVVGVMLGYLFGVSFPTVNITKLHFPSSIISYIEDRNSGI TTQTLLNHAWASANRHNKNNSDSTSEEVPKLQLYRFLRQQL*(+) MRGHLQIVITKTIPIQPLKKFLSCSSTGFFGSNCSRKERGEDSQFIWQNLLIALAVARQDQMRG *(+) MNCESSPLSFLLQLLPKKPVELQLRNFFRG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |