Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0523500_circ_g.6 |
ID in PlantcircBase | osa_circ_014839 |
Alias | Os_ciR7768 |
Organism | Oryza sativa |
Position | chr2: 19101434-19101664 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os02g0523500 |
Parent gene annotation |
Similar to 110 kDa 4SNc-Tudor domain protein (Fragment). (Os02t0 523500-01);Similar to RNA binding protein Rp120. (Os02t0523500-0 2) |
Parent gene strand | - |
Alternative splicing | Os02g0523500_circ_g.5 Os02g0523500_circ_g.7 Os02g0523500_circ_g.8 Os02g0523500_circ_g.9 Os02g0523500_circ_g.10 Os02g0523500_circ_g.11 Os02g0523500_circ_g.12 Os02g0523500_circ_g.13 Os02g0523500_circ_g.14 Os02g0523500_circ_g.15 Os02g0523500_circ_g.16 |
Support reads | 2/104 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0523500-02:1 Os02t0523500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.742642424 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19101538-19101488(+) 19101468-19101436(-) 19101443-19101564(-) |
Potential amino acid sequence |
MLQVSLGIVSLKRWPLKTYSTIAECLLFRCKKGRKSLAFFAETSTSRCRILLLIKAIASFE*(+ ) MRRRILQRDVEVSAKKARDFLPFLQRNRRHSAIVEYVFSGHRFKLTIPKETCSIAFSFSGVRCP GKDEPYSNEAIALMRRRILQRDVEVSAKKARDFLPFLQRNRRHSAIVEYVFSGHRFKLTIPKET CSIAFSFSGVRCPGKDEPYSNEAIALMRRRILQRDVEVSAKKARDFLPFLQRNRRHSAIVEYVF SGHRFKLTIPKETCSIAFSFSGVRCPGKDEPYSNEAIALMRRRILQRDVE(-) MWRFQQRRPETSFLSYSGTEDIPQLLNMSSVATVSN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |