Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0523500_circ_g.13 |
| ID in PlantcircBase | osa_circ_014846 |
| Alias | Os_ciR7772 |
| Organism | Oryza sativa |
| Position | chr2: 19103271-19103995 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0523500 |
| Parent gene annotation |
Similar to 110 kDa 4SNc-Tudor domain protein (Fragment). (Os02t0 523500-01);Similar to RNA binding protein Rp120. (Os02t0523500-0 2) |
| Parent gene strand | - |
| Alternative splicing | Os02g0523500_circ_g.5 Os02g0523500_circ_g.6 Os02g0523500_circ_g.7 Os02g0523500_circ_g.8 Os02g0523500_circ_g.9 Os02g0523500_circ_g.10 Os02g0523500_circ_g.11 Os02g0523500_circ_g.12 Os02g0523500_circ_g.14 Os02g0523500_circ_g.15 Os02g0523500_circ_g.16 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0523500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.486588637 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19103929-19103271(+) 19103969-19103416(+) 19103409-19103943(-) |
| Potential amino acid sequence |
MQSFLRNSLLSQANGSSTPPRRA*(+) MVHPLHHGEPELQQHISEQIGNLGASKHELYCHHELVQQWLPDSCLYSQLQNPLHQNH*(+) MQRVLQLRIKARVWKPLLNKFVMAVQFVFTCSQVSNLFRYMLLEFRLAVVEWMNHLLGKAGSF* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |