Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0472600_circ_g.2 |
ID in PlantcircBase | osa_circ_037326 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 23276309-23277525 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0472600 |
Parent gene annotation |
Alpha1,3-fucosyltransferase, Basipetal auxin transport, Gravitro pic response, N-glycan biosynthesis (Os08t0472600-01) |
Parent gene strand | + |
Alternative splicing | Os08g0472600_circ_g.1 Os08g0472600_circ_g.3 Os08g0472600_circ_g.4 Os08g0472600_circ_g.5 Os08g0472600_circ_g.6 Os08g0472600_circ_g.7 Os08g0472600_circ_g.8 Os08g0472600_circ_g.9 Os08g0472600_circ_g.10 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0472600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.250628478 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23276329-23276325(+) 23276438-23276516(-) |
Potential amino acid sequence |
MTTSLSSDVPVGYFSWAEYDIMAPVPPKTEEALAAAFISNCGARNFRLQALEMLESLDVKIDSY GSCHRNHDGKVDKVETLKRYKFSLAFENSNEEDYVTEKFFQSLVTGEVTKL*(+) MLQLGLLQFLEAQVPLYHIQPMKSSQQVHLRKGLLSSQFCNLSCYQRLKKLFCNIIFLVGILKG QAKFVALQSFHFINFAIMITMATTI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |