Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0349500_circ_g.3 |
| ID in PlantcircBase | osa_circ_023486 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 16646273-16646448 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os04g0349500 |
| Parent gene annotation |
Similar to 40S ribosomal protein S8. (Os04t0349500-01) |
| Parent gene strand | - |
| Alternative splicing | Os04g0349500_circ_g.2 Os04g0349500_circ_g.4 Os04g0349500_circ_g.5 Os04g0349500_circ_g.6 Os04g0349500_circ_g.7 Os04g0349500_circ_g.8 |
| Support reads | 392 |
| Tissues | shoot, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0349500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.437804356 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16646402-16646374(+) |
| Potential amino acid sequence |
MVALFCFLRGSLTLLSPSALPHCPGREEMQAKSLPLPNCSSMCESRVRVC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |