Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0349500_circ_g.3 |
ID in PlantcircBase | osa_circ_023486 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 16646273-16646448 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os04g0349500 |
Parent gene annotation |
Similar to 40S ribosomal protein S8. (Os04t0349500-01) |
Parent gene strand | - |
Alternative splicing | Os04g0349500_circ_g.2 Os04g0349500_circ_g.4 Os04g0349500_circ_g.5 Os04g0349500_circ_g.6 Os04g0349500_circ_g.7 Os04g0349500_circ_g.8 |
Support reads | 392 |
Tissues | shoot, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0349500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.437804356 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16646402-16646374(+) |
Potential amino acid sequence |
MVALFCFLRGSLTLLSPSALPHCPGREEMQAKSLPLPNCSSMCESRVRVC*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |