Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d003872_circ_g.2 |
ID in PlantcircBase | zma_circ_007190 |
Alias | zma_circ_0001078 |
Organism | Zea mays |
Position | chr2: 64332669-64332867 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d003872 |
Parent gene annotation |
Coilin |
Parent gene strand | - |
Alternative splicing | Zm00001d003872_circ_igg.1 Zm00001d003872_circ_g.1 Zm00001d003872_circ_ag.1 Zm00001d003875_circ_igg.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d003872_T001:1 Zm00001d003872_T002:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.250587867 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
64332796-64332688(+) 64332860-64332752(+) 64332814-64332838(-) |
Potential amino acid sequence |
MGQASHLDCLMMDNQQLLVNLHAHSAGSKRM*(+) MHILLAQSECDQAEPQLGQSHPTFQIRPHLL*(+) MACLSHQAIKMDHMFIFQASKQMRTNLKRRMRLSQLWFGLVTFALSQQNVHGDSPIAADCPSSS NQDGLPVPSSNQNGSHVHFSSLKADEDESETSDEIVPVVVRPGHIRFEPAECAWRFTNSC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |