Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d003872_circ_g.1 |
ID in PlantcircBase | zma_circ_007189 |
Alias | zma_circ_0001077 |
Organism | Zea mays |
Position | chr2: 64326306-64332867 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d003872 |
Parent gene annotation |
Coilin |
Parent gene strand | - |
Alternative splicing | Zm00001d003872_circ_igg.1 Zm00001d003872_circ_ag.1 Zm00001d003872_circ_g.2 Zm00001d003875_circ_igg.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d003872_T002:2 Zm00001d003872_T001:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.019504361 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
64332796-64332752(+) 64332814-64332845(-) |
Potential amino acid sequence |
MGQASHLDCLMMDNQQLLVNLHAHSVILLLAICRVLCLLAQSECDQAEPQLGQSHPTFQIRPHL L*(+) MACLSHQAIKMDHMFIFQASKQMRTNLKRRMRLSQLWFGLVTFALSQQAENPTNRQQKNYRMCM EIHQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |