Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0576700_circ_g.2 |
ID in PlantcircBase | osa_circ_015150 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 22153853-22154253 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os02g0576700 |
Parent gene annotation |
Nucleosome assembly protein (NAP) family protein, H3/H4 histone chaperone, Abiotic stress response and adaptation (Os02t0576700- 01) |
Parent gene strand | - |
Alternative splicing | Os02g0576700_circ_g.3 Os02g0576700_circ_g.4 |
Support reads | 5 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0576700-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.173940378 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22154255-22154189(-) 22154024-22154221(-) |
Potential amino acid sequence |
MFKYLESVDVDDSKDVKSGYSITLTFSENPYFEDKELTKTYAFADDGTTTINATSIKWKEGMEI ANGNAKKKGSKRPLVEERCSSTWSLSTWMILKMSSQATP*(-) MLLALSGKKEWKLQMGMPRRKGASDHWLRKDVQVPGVCRRG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |