Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0576700_circ_g.4 |
| ID in PlantcircBase | osa_circ_015152 |
| Alias | Os_ciR7830 |
| Organism | Oryza sativa |
| Position | chr2: 22154393-22154664 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0576700 |
| Parent gene annotation |
Nucleosome assembly protein (NAP) family protein, H3/H4 histone chaperone, Abiotic stress response and adaptation (Os02t0576700- 01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0576700_circ_g.2 Os02g0576700_circ_g.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0576700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011902 |
| PMCS | 0.307373897 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22154433-22154425(+) |
| Potential amino acid sequence |
MTQKRCQPEVGDCLDNVTPSEIDRSANLTVFLLDLQNLVTSFLIDLLILFGQKLTK*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |