Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0614300_circ_g.1 |
ID in PlantcircBase | osa_circ_034749 |
Alias | Os_ciR11093 |
Organism | Oryza sativa |
Position | chr7: 25302937-25303790 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os07g0614300 |
Parent gene annotation |
Similar to Von Willebrand factor type A domain containing protei n, expressed. (Os07t0614300-01) |
Parent gene strand | + |
Alternative splicing | Os07g0614250_circ_g.1 Os07g0614250_circ_g.2 Os07g0614250_circ_g.3 Os07g0614250_circ_g.4 Os07g0614250_circ_g.5 Os07g0614250_circ_g.6 Os07g0614250_circ_g.7 Os07g0614250_circ_g.8 Os07g0614300_circ_g.2 Os07g0614300_circ_g.3 Os07g0614300_circ_g.4 Os07g0614300_circ_g.5 |
Support reads | 2/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0614250-00:3 Os07t0614250-00:3 Os07t0614300-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.145880094 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25303494-25302987(+) |
Potential amino acid sequence |
MVTAKGYLADMREISIELKVQHIKDIPLDKVLAAQQIGLLTAKAWLSSDKQLERKDQLRVRYLG GSGKHRVQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |