Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0614300_circ_g.4 |
| ID in PlantcircBase | osa_circ_034752 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 25303412-25303790 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0614300 |
| Parent gene annotation |
Similar to Von Willebrand factor type A domain containing protei n, expressed. (Os07t0614300-01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0614250_circ_g.1 Os07g0614250_circ_g.2 Os07g0614250_circ_g.3 Os07g0614250_circ_g.4 Os07g0614250_circ_g.5 Os07g0614250_circ_g.6 Os07g0614250_circ_g.7 Os07g0614250_circ_g.8 Os07g0614300_circ_g.1 Os07g0614300_circ_g.2 Os07g0614300_circ_g.3 Os07g0614300_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0614250-00:2 Os07t0614250-00:2 Os07t0614300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.217235466 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25303494-25303787(+) 25303439-25303512(-) |
| Potential amino acid sequence |
MVTAKGYLADMREISIELKVQHIKDIPLDKVLAAQQIGLLTAKAWLSSDKQLERKIDSEYIPDI SAKSPLCISGKYQGKFPDMVTAKGYLADMREISIELKVQHIKDIPLDKVLAAQQIGLLTAKAWL SSDKQLERKIDSEYIPDISAKSPLCISGKYQGKFPDMVTAKGYLADMREISIELKVQHIKDIPL DKVLAAQQIGLLTAKAWLSSDKQLERKIDSEYIPDISAKSPLCISGKYQGKFPDMVTAKGYLAD MREISIELKVQHIKDIPLDKVLAAQQIGLLTAKAWLSSDKQLERK(+) MSGMYSESIFLSSCLSEESHAFAVRRPICCAAKTLSRGISFICCTLSSIEISLMSAK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |