Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0206700_circ_g.3 |
| ID in PlantcircBase | osa_circ_033174 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 5752738-5752938 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0206700 |
| Parent gene annotation |
Cycloartenol-C-24-methyltransferase 1 (EC 2.1.1.41) (24-sterol C - methyltransferase 1) (Sterol C-methyltransferase 1). (Os07t020 6700-01);Similar to Cycloartenol-C-24-methyltransferase 1. (Os07 t0206700-02) |
| Parent gene strand | - |
| Alternative splicing | Os07g0206700_circ_g.4 Os07g0206700_circ_g.5 Os07g0206700_circ_g.6 Os07g0206700_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0206700-01:1 Os07t0206700-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.295607421 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5752882-5752907(-) |
| Potential amino acid sequence |
MSGVLLITMNRTMQHTRGSRMKSSLAMACQISEALNNVFKLQKMLGLRLAAIRRSIVY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |