Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | ENSRNA049471535_circ_g.2 |
| ID in PlantcircBase | osa_circ_040540 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 24615788-24616027 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI-long |
| Parent gene | EPlOSAG00000045065 |
| Parent gene annotation |
ncRNA |
| Parent gene strand | + |
| Alternative splicing | Os01g0618700_circ_ig.1 ENSRNA049471535_circ_igg.1 ENSRNA049471535_circ_igg.2 ENSRNA049471535_circ_igg.3 ENSRNA049471535_circ_igg.4 ENSRNA049471535_circ_igg.5 ENSRNA049471535_circ_igg.6 Os01g0618700_circ_ig.7 Os01g0618700_circ_ig.8 Os01g0618700_circ_ig.9 ENSRNA049471535_circ_g.1 ENSRNA049471535_circ_g.3 ENSRNA049471535_circ_g.4 ENSRNA049471535_circ_igg.5 ENSRNA049471535_circ_g.6 ENSRNA049471535_circ_igg.7 |
| Support reads | NA |
| Tissues | root, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | AA-CA |
| Number of exons covered | ENSRNA049471535-T1:1 EPlOSAT00000046453:1 ENSRNA049471535-T1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010351 |
| PMCS | 0.536219444 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24615956-24616014(-) |
| Potential amino acid sequence |
MISARAQRAPHVSLPPREEEGASAETFRVSAAASLRLRARGLSRATKSPLTSSCARCTQS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | this study |