Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G101500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000713 |
| Alias | Chr07:7533969|7534387 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 7533969-7534387 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G101500 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 5 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.007G101500.1:2 Gorai.007G101500.5:2 Gorai.007G101500.2:2 Gorai.007G101500.4:2 Gorai.007G101500.3:2 Gorai.007G101500.6:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000845* |
| PMCS | 0.462251551 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7534017-7533973(+) 7534301-7533973(+) |
| Potential amino acid sequence |
MNAEIRRTKARLLEELPKLQRLALKKVKGISKEELEARNDLVYSLKDRVDSIPDGSSTATKQST GGWATSTSSTGIKFDSSSEI*(+) MDHQLQLSKVLVVGQLQLPPPALNLIHLQKSEAAATEKNRATAVAMNAEIRRTKARLLEELPKL QRLALKKVKGISKEELEARNDLVYSLKDRVDSIPDGSSTATKQSTGGWATSTSSTGIKFDSSSE I*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |