Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Cotton_A_15112_circ_g.1 |
| ID in PlantcircBase | gar_circ_000845 |
| Alias | CA_chr7_BGI-A2_v1.0:99843188|99843607 |
| Organism | Gossypium arboreum |
| Position | chrCA_chr7_BGI-A2_v1.0: 99843188-99843607 JBrowse» |
| Reference genome | BGI-A2_v1.0 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Cotton_A_15112 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Cotton_A_15112:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gra_circ_000713* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
99843236-99843192(+) 99843521-99843192(+) |
| Potential amino acid sequence |
MNAEIRRTKARLLEELPKLQRLALKKVKGISKEELEARNDLVYSLKDRIDSIPDGSSTATKQST GGWATSTSSTGIKFDSSSEI*(+) MDHQLQLSKVLVVGQLQLPPLALNLIHLQKSEAAATEKNRATAVAMNAEIRRTKARLLEELPKL QRLALKKVKGISKEELEARNDLVYSLKDRIDSIPDGSSTATKQSTGGWATSTSSTGIKFDSSSE I*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |