Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA004735_circ_g.2 |
ID in PlantcircBase | osi_circ_002510 |
Alias | 1:38955712|38956176 |
Organism | Oryza sativa ssp. indica |
Position | chr1: 38955712-38956176 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA004735 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA004735_circ_g.1 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA004735-TA:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_004692* osa_circ_004691 |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
38956053-38956170(-) 38955887-38955886(+) |
Potential amino acid sequence |
MLLPALPARSHDLHVEGVHPPDVGVEDEVVDAAPVLCVRRDRVRLDDPVLDAVDLGVVGVGLHQ ERRPVELHRRVVLLM*(-) MNTLNMKIMRPGGQSWEEHDEVVRIEAYRKVLTTWASWVNDNIDPARTSVFFMSISPLHIRSTT RRWSSTGRRSWWSPTPTTPRSTASSTGSSRRTRSRRTHRTGAASTTSSSTPTSGG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | leaf senescence |
Other Information | |
---|---|
References | Huang et al., 2021 |