Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0830700_circ_g.3 |
| ID in PlantcircBase | osa_circ_004692 |
| Alias | Os_ciR1846, |
| Organism | Oryza sativa |
| Position | chr1: 35539899-35540363 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, circseq_cup, find_circ, CIRI-long |
| Parent gene | Os01g0830700 |
| Parent gene annotation |
Protein of unknown function DUF231, plant domain containing prot ein. (Os01t0830700-01);Protein of unknown function DUF231, plant domain containing protein. (Os01t0830700-02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0830700_circ_g.1 Os01g0830700_circ_g.2 |
| Support reads | 6/18/21 |
| Tissues | root/root/shoot, root, anther, pistil, root, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0830700-01:2 Os01t0830700-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002510* osi_circ_010891 |
| PMCS | 0.609875666 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35540074-35540073(+) 35540240-35540357(-) |
| Potential amino acid sequence |
MNTLNMKIMRPGGQSWEEHDEVVRIEAYRKVLTTWASWVNDNIDPARTSVFFMSISPLHIRSTT RRWSSTGRRSWWSPTPTTPRSTASSTGSSRRTRSRRTHRTGAASTTSSSTPTSGG*(+) MLLPALPARSHDLHVEGVHPPDVGVEDEVVDAAPVLCVRRDRVRLDDPVLDAVDLGVVGVGLHQ ERRPVELHRRVVLLM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017; this study |