Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA005350_circ_g.3 |
| ID in PlantcircBase | osi_circ_004432 |
| Alias | 2:37373856|37375027 |
| Organism | Oryza sativa ssp. indica |
| Position | chr2: 37373856-37375027 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA005350 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA005350_circ_g.1 BGIOSGA005350_circ_g.2 BGIOSGA005350_circ_g.4 BGIOSGA005350_circ_g.5 BGIOSGA005350_circ_igg.1 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA005350-TA:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_002184 |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
37374776-37375011(-) 37374953-37373896(+) 37374963-37374745(+) |
| Potential amino acid sequence |
MDEEVGKRFYPMVPVPHVPKINGEIPSVDEATMDHERLTERCITSG*(-) MPTDGLYKSYVSAEECKCVSSGCDASFCQPFMVHGSFID*(+) MGCTNHMSVQKNASASHPDVMHLSVSLSWSMVASSTEGISPLILGTWGTGTMG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |