Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA005350_circ_g.3 |
ID in PlantcircBase | osi_circ_004432 |
Alias | 2:37373856|37375027 |
Organism | Oryza sativa ssp. indica |
Position | chr2: 37373856-37375027 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA005350 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA005350_circ_g.1 BGIOSGA005350_circ_g.2 BGIOSGA005350_circ_g.4 BGIOSGA005350_circ_g.5 BGIOSGA005350_circ_igg.1 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA005350-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_002184 |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
37374776-37375011(-) 37374953-37373896(+) 37374963-37374745(+) |
Potential amino acid sequence |
MDEEVGKRFYPMVPVPHVPKINGEIPSVDEATMDHERLTERCITSG*(-) MPTDGLYKSYVSAEECKCVSSGCDASFCQPFMVHGSFID*(+) MGCTNHMSVQKNASASHPDVMHLSVSLSWSMVASSTEGISPLILGTWGTGTMG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |