Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA013680_circ_g.3 |
ID in PlantcircBase | osi_circ_005157 |
Alias | 3:36761336|36762607 |
Organism | Oryza sativa ssp. indica |
Position | chr3: 36761336-36762607 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA013680 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA013680_circ_igg.1 BGIOSGA013680_circ_g.1 BGIOSGA013680_circ_g.2 BGIOSGA013680_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA013680-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_022138* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
36762505-36761339(+) 36761405-36761416(+) |
Potential amino acid sequence |
MIYPLVQNILEFIIHWMRLQGYSMIQVGPSNTISRS*(+) MVKSVKQAMENGEGCRVYGVLDVQRVAGNFHISVHGLNIFVAEKIFDGSSHVNVSHIIHDLSFG PKYPGIHNPLDETTRILHDTSGTFKYYIKIMTMSMKMNKRSKSTPLMKMQKKWLRV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |