Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA030331_circ_g.1 |
ID in PlantcircBase | osi_circ_007962 |
Alias | 9:2707230|2713585 |
Organism | Oryza sativa ssp. indica |
Position | chr9: 2707230-2713585 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA030331 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA030331_circ_g.2 BGIOSGA030331_circ_g.3 BGIOSGA030331_circ_g.4 BGIOSGA030331_circ_g.5 BGIOSGA030331_circ_g.6 BGIOSGA030331_circ_g.7 BGIOSGA030331_circ_g.8 BGIOSGA030331_circ_g.9 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA030331-TA:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2707270-2713510(-) 2707630-2707253(+) |
Potential amino acid sequence |
MTEWLINRISQPSLRYIRKQGCHKQESTTNYYAHYDSR*(-) MGSSFFVILLIMKNLGKSNKRLRFLRASGPLTAVVFGTIFVKIFHPSSISVVGEIPQGLPKFSI PRGFEHLMSLMPTAVLITGVAILESVGIAKALAAKNGYELDPNKELFGLGIANICGSFFSSYPA TGSFSRSAVNHESGAKTGLSGIIMGIIIGGALLFMTPLFTDIPQARLAYSIY*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |