Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G28540_circ_g.7 |
ID in PlantcircBase | ath_circ_015399 |
Alias | At_ciR1722 |
Organism | Arabidpsis thaliana |
Position | chr2: 12219454-12219813 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder, find_circ, CIRI-full |
Parent gene | AT2G28540 |
Parent gene annotation |
Putative uncharacterized protein At2g28540 |
Parent gene strand | + |
Alternative splicing | AT2G28540_circ_g.2 AT2G28540_circ_g.3 AT2G28540_circ_g.4 AT2G28540_circ_g.5 AT2G28540_circ_g.6 AT2G28540_circ_g.8 AT2G28540_circ_g.9 AT2G28540_circ_g.10 |
Support reads | 5/5 |
Tissues | leaf/leaf, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G28540.2:2 AT2G28540.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.259525462 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12219572-12219810(+) |
Potential amino acid sequence |
MSLPFDLADEDMFQRREYFGQYGKVVKVAMSRTAAGAVQQFPNNTCSVLVAEFYIDRKKSQKAK PKPAEGRKDLTGVRVIQRNLVYVMSLPFDLADEDMFQRREYFGQYGKVVKVAMSRTAAGAVQQF PNNTCSVLVAEFYIDRKKSQKAKPKPAEGRKDLTGVRVIQRNLVYVMSLPFDLADEDMFQRREY FGQYGKVVKVAMSRTAAGAVQQFPNNTCSVLVAEFYIDRKKSQKAKPKPAEGRKDLTGVRVIQR NLVYVMSLPFDLADEDMFQRREYFGQYGKVVKVAMSRTAAGAVQQFPNNTCS(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |