Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0622400_circ_g.1 |
| ID in PlantcircBase | osa_circ_015554 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 24781204-24782364 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0622400 |
| Parent gene annotation |
Glycolipid transfer protein, GLTP domain containing protein. (Os 02t0622400-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0622300_circ_g.1 Os02g0622350_circ_ag.1 Os02g0622300_circ_g.2 Os02g0622350_circ_g.1 Os02g0622400_circ_g.2 Os02g0623400_circ_ig.1 Os02g0623500_circ_igg.1 Os02g0623500_circ_igg.2 Os02g0623500_circ_g.1 Os02g0623500_circ_g.2 Os02g0623500_circ_g.3 Os02g0623500_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0622400-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.161010968 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24781222-24781230(+) 24781528-24782344(-) |
| Potential amino acid sequence |
MALVKSDIGGNITRLENKYSSDPSKYEQLYSMVQEEVQNKTAKGSSSCTNGLLWLTRAMDFLVE LFRNLLEHQDWTMSQACTDSYTKTLKKWHGWLASSSFTVAMKLAPNREKFMEVISGTGDIKADI EKFCTTFYPFLKENHDFLINLELLWHL*(+) MLYNCSYFDGSEEYLFSSLVILPPMSLFTSAIAAPNLSENHDSL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |