Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0622300_circ_g.2 |
| ID in PlantcircBase | osa_circ_015552 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 24778421-24779435 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0622300 |
| Parent gene annotation |
Ribosomal protein L14 family protein. (Os02t0622300-00) |
| Parent gene strand | - |
| Alternative splicing | Os02g0622300_circ_g.1 Os02g0622350_circ_ag.1 Os02g0622350_circ_g.1 Os02g0622400_circ_g.1 Os02g0622400_circ_g.2 Os02g0623400_circ_ig.1 Os02g0623500_circ_igg.1 Os02g0623500_circ_igg.2 Os02g0623500_circ_g.1 Os02g0623500_circ_g.2 Os02g0623500_circ_g.3 Os02g0623500_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0622300-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.385255435 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24778531-24779355(-) |
| Potential amino acid sequence |
MVRCQINFKRLSLTDIKIDIKRVPKKTTLIKAMEEAAVQEVRGDRAGGPGELRQGLRPPRRHR* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |