Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0622300_circ_g.2 |
ID in PlantcircBase | osa_circ_015552 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 24778421-24779435 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0622300 |
Parent gene annotation |
Ribosomal protein L14 family protein. (Os02t0622300-00) |
Parent gene strand | - |
Alternative splicing | Os02g0622300_circ_g.1 Os02g0622350_circ_ag.1 Os02g0622350_circ_g.1 Os02g0622400_circ_g.1 Os02g0622400_circ_g.2 Os02g0623400_circ_ig.1 Os02g0623500_circ_igg.1 Os02g0623500_circ_igg.2 Os02g0623500_circ_g.1 Os02g0623500_circ_g.2 Os02g0623500_circ_g.3 Os02g0623500_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0622300-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.385255435 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24778531-24779355(-) |
Potential amino acid sequence |
MVRCQINFKRLSLTDIKIDIKRVPKKTTLIKAMEEAAVQEVRGDRAGGPGELRQGLRPPRRHR* (-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |