Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0170300_circ_g.1 |
ID in PlantcircBase | osa_circ_006307 |
Alias | Os_ciR6966 |
Organism | Oryza sativa |
Position | chr10: 4836438-4837330 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os10g0170300 |
Parent gene annotation |
Alkaline-phosphatase-like, core domain domain containing protein . (Os10t0170300-01) |
Parent gene strand | + |
Alternative splicing | Os10g0170300_circ_g.2 Os10g0170300_circ_g.3 Os10g0170300_circ_g.4 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os10t0170300-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.236443272 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4836453-4836805(+) 4836890-4837105(-) |
Potential amino acid sequence |
MDKLQVLQRLAADEKTSARIFKALADPPTTSLQRLKALTTGGLPTFIDVGNSFGAPAIVEDNIM HQFAKNGKRVVMMGDDTWIQLYPEHFNKSYPYPSFNVKDLDTVDNGVIEHLLPSLHKNDWDVLI AHFLGVRGNHGWTNCRFCKDWLLMRRPLLGYSKRLLIHRRLAFNVLRL*(+) MHYVVFYYCWSSKAISHINKCRQTTCRQSLKTLKASRRWISKRFEYPSRGLLISSQSLQNLQFV HPWLPLTPRKCAIRTSQSFLCNDGSKCSITPLSTVSRSLTLKEG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |