Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0170300_circ_g.3 |
ID in PlantcircBase | osa_circ_006309 |
Alias | Os_ciR2155 |
Organism | Oryza sativa |
Position | chr10: 4837247-4838655 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os10g0170300 |
Parent gene annotation |
Alkaline-phosphatase-like, core domain domain containing protein . (Os10t0170300-01) |
Parent gene strand | + |
Alternative splicing | Os10g0170300_circ_g.1 Os10g0170300_circ_g.2 Os10g0170300_circ_g.4 |
Support reads | 6/2 |
Tissues | root/shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os10t0170300-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008818 |
PMCS | 0.242163301 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4837469-4837247(+) |
Potential amino acid sequence |
MIQKLEQYNRILEDVIDTLKSLSTSGGPHENTLLLVMGDHGQTLNGDHGGGTAEEVETSLFAWS PKTPPNAVLSVLGKNLCNADLHGKEVCVSTMQQLDFAVTIAALLGIPFPFGR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |