Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0628500_circ_g.4 |
| ID in PlantcircBase | osa_circ_012433 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 26907539-26907977 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0628500 |
| Parent gene annotation |
Similar to Methionine aminopeptidase. (Os12t0628500-01) |
| Parent gene strand | + |
| Alternative splicing | Os12g0628500_circ_g.1 Os12g0628500_circ_g.2 Os12g0628500_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0628500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.149012339 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26907937-26907565(+) 26907644-26907565(+) 26907605-26907970(-) |
| Potential amino acid sequence |
MYNAVRRAAEVHRQKEERPSSAD*(+) MITYGEQLVRKRGNWSGYKSRCTMLFAEQQKFIDRKKKGPLQQTDPPSIPIDELFPSGDFPEGE IQQYKDDNLWRTTSEEKRELERLQKPMYNAVRRAAEVHRQKEERPSSAD*(+) MGKVRLWELMEDQSAEEGLSSFCL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |