Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0628500_circ_g.1 |
| ID in PlantcircBase | osa_circ_012430 |
| Alias | Os_ciR7492 |
| Organism | Oryza sativa |
| Position | chr12: 26906721-26907646 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os12g0628500 |
| Parent gene annotation |
Similar to Methionine aminopeptidase. (Os12t0628500-01) |
| Parent gene strand | + |
| Alternative splicing | Os12g0628500_circ_g.2 Os12g0628500_circ_g.3 Os12g0628500_circ_g.4 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0628500-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010014 |
| PMCS | 0.237664705 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26906759-26906739(+) |
| Potential amino acid sequence |
MAGGSADAVTKEMEALLVGQNPNAVSGETCETSSKEGKVADSNGSHSSPPEDDDDEAQGDGPSQ DGGSEAAKKKKKKSKSKKKKGPLQQTDPPSIPIDELFPSGDFPEGEIQQYKDEFVITGQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |