Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0628500_circ_g.1 |
ID in PlantcircBase | osa_circ_012430 |
Alias | Os_ciR7492 |
Organism | Oryza sativa |
Position | chr12: 26906721-26907646 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os12g0628500 |
Parent gene annotation |
Similar to Methionine aminopeptidase. (Os12t0628500-01) |
Parent gene strand | + |
Alternative splicing | Os12g0628500_circ_g.2 Os12g0628500_circ_g.3 Os12g0628500_circ_g.4 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0628500-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010014 |
PMCS | 0.237664705 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26906759-26906739(+) |
Potential amino acid sequence |
MAGGSADAVTKEMEALLVGQNPNAVSGETCETSSKEGKVADSNGSHSSPPEDDDDEAQGDGPSQ DGGSEAAKKKKKKSKSKKKKGPLQQTDPPSIPIDELFPSGDFPEGEIQQYKDEFVITGQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |