Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0152900_circ_g.4 |
| ID in PlantcircBase | osa_circ_035874 |
| Alias | Os_ciR11627 |
| Organism | Oryza sativa |
| Position | chr8: 3033478-3035133 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os08g0152900 |
| Parent gene annotation |
Armadillo-like helical domain containing protein. (Os08t0152900- 01) |
| Parent gene strand | - |
| Alternative splicing | Os08g0152900_circ_g.1 Os08g0152900_circ_g.2 Os08g0152900_circ_g.3 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0152900-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.113458771 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3034926-3035116(-) |
| Potential amino acid sequence |
MVHALMSCVTTGNVKVQWNVCHALSNLFMNDTLRLPDMPWASSVYSILLLLLRDSNNYKIRMHA AVALAVPVSRLGKVKRC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |