Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0152900_circ_g.2 |
| ID in PlantcircBase | osa_circ_035872 |
| Alias | Os_ciR11626 |
| Organism | Oryza sativa |
| Position | chr8: 3032772-3033584 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, circseq_cup, find_circ |
| Parent gene | Os08g0152900 |
| Parent gene annotation |
Armadillo-like helical domain containing protein. (Os08t0152900- 01) |
| Parent gene strand | - |
| Alternative splicing | Os08g0152900_circ_g.1 Os08g0152900_circ_g.3 Os08g0152900_circ_g.4 |
| Support reads | 2/4/3 |
| Tissues | root/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0152900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018192 |
| PMCS | 0.343023869 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3033016-3032796(+) 3033522-3033569(-) |
| Potential amino acid sequence |
MINCWNSMTQEHARFLEQHLEMSYHNQAVRLELLRQQLHASLSCNCLSHGVVAEVCYKHLMPLI RKSLRL*(+) MHAAVALAVPVSRLDYGSSFPDVVRGIEHVLESLSSNSLSSPSNFKHKGNLEKQVTFTALHLFS FVSPKDDQSLRDFLIKGIKCL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |