Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0152900_circ_g.2 |
ID in PlantcircBase | osa_circ_035872 |
Alias | Os_ciR11626 |
Organism | Oryza sativa |
Position | chr8: 3032772-3033584 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, circseq_cup, find_circ |
Parent gene | Os08g0152900 |
Parent gene annotation |
Armadillo-like helical domain containing protein. (Os08t0152900- 01) |
Parent gene strand | - |
Alternative splicing | Os08g0152900_circ_g.1 Os08g0152900_circ_g.3 Os08g0152900_circ_g.4 |
Support reads | 2/4/3 |
Tissues | root/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0152900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018192 |
PMCS | 0.343023869 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3033016-3032796(+) 3033522-3033569(-) |
Potential amino acid sequence |
MINCWNSMTQEHARFLEQHLEMSYHNQAVRLELLRQQLHASLSCNCLSHGVVAEVCYKHLMPLI RKSLRL*(+) MHAAVALAVPVSRLDYGSSFPDVVRGIEHVLESLSSNSLSSPSNFKHKGNLEKQVTFTALHLFS FVSPKDDQSLRDFLIKGIKCL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |