Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d001913_circ_g.2 |
| ID in PlantcircBase | zma_circ_000140 |
| Alias | NA |
| Organism | Zea mays |
| Position | chr2: 2801707-2801811 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Zm00001d001913 |
| Parent gene annotation |
Ubiquitin-conjugating enzyme E2 11 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d001913_circ_g.1 |
| Support reads | 7 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d001913_T002:1 Zm00001d001913_T001:1 Zm00001d001913_T004:1 Zm00001d001913_T003:1 Zm00001d001913_T005:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_025862 |
| PMCS | 0.445402628 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2801773-2801709(-) |
| Potential amino acid sequence |
MSRQMLPLLLMFGWKTLVRKDTFEIVKAGLHCSLRMSRQMLPLLLMFGWKTLVRKDTFEIVKAG LHCSLRMSRQMLPLLLMFGWKTLVRKDTFEIVKAGLHCSLRMSRQMLPLLLMFGWKTLVRKD(- ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |