Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0667800_circ_g.4 |
| ID in PlantcircBase | osa_circ_025862 |
| Alias | Os_ciR2427 |
| Organism | Oryza sativa |
| Position | chr4: 34088626-34088730 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os04g0667800 |
| Parent gene annotation |
Ubiquitin-conjugating enzyme (EC 6.3.2.19) (Ubiquitin carrier pr otein). (Os04t0667800-01);Similar to Ubiquitin carrier protein. (Os04t0667800-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4/7 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0667800-02:1 Os04t0667800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_000140 zma_circ_003791 |
| PMCS | 0.608111349 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34088634-34088727(+) 34088689-34088628(-) |
| Potential amino acid sequence |
MVSAGLHCSLRMSRQMLPLLLMFGWKTLVRKETFDMVSAGLHCSLRMSRQMLPLLLMFGWKTLV RKETFDMVSAGLHCSLRMSRQMLPLLLMFGWKTLVRKETFDMVSAGLHCSLRMSRQMLPLLLMF GWKTLVRKE(+) MAAFASTSSRNSGVLHLPYQRSLSAPRFSTRTLIAMAAFASTSSRNSGVLHLPYQRSLSAPRFS TRTLIAMAAFASTSSRNSGVLHLPYQRSLSAPRFSTRTLIAMAAFASTSSRNSGVLHLPYQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |