Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA014213_circ_g.3 |
ID in PlantcircBase | osi_circ_005797 |
Alias | 4:32130168|32130633 |
Organism | Oryza sativa ssp. indica |
Position | chr4: 32130168-32130633 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA014213 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA014213_circ_g.1 BGIOSGA014213_circ_g.2 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA014213-TA:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_025672* zma_circ_010377* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32130498-32130609(-) 32130592-32130214(+) |
Potential amino acid sequence |
MDYAFDFIINNGGIDTEDDYPYKGKDERCDVNRKNAKVVTIDSYEDVTPNSETSLQKAVANQPV SVAIEAGGRAFQLYSSEVAGLSQQ*(-) MPSTAAIAEKAQQLPMSRAGMLCHRLQLQH*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |