Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0650000_circ_g.4 |
| ID in PlantcircBase | osa_circ_025672 |
| Alias | Os_ciR2426 |
| Organism | Oryza sativa |
| Position | chr4: 33124967-33125432 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0650000 |
| Parent gene annotation |
Similar to Oryzain alpha chain precursor (EC 3.4.22.-). (Os04t06 50000-01);Similar to Oryzain alpha chain precursor (EC 3.4.22.-) . (Os04t0650000-02);Similar to cDNA clone:J013002H09, full inser t sequence. (Os04t0650000-03) |
| Parent gene strand | - |
| Alternative splicing | Os04g0650000_circ_g.5 |
| Support reads | 4/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0650000-03:1 Os04t0650000-02:2 Os04t0650000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005797* osi_circ_014941 zma_circ_010377* |
| PMCS | 0.40915068 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33125391-33125013(+) 33125297-33125408(-) |
| Potential amino acid sequence |
MPSTAAIAEKAQQLPMSRAGMLCHRLQLQH*(+) MDYAFDFIINNGGIDTEDDYPYKGKDERCDVNRKNAKVVTIDSYEDVTPNSETSLQKAVANQPV SVAIEAGGRAFQLYSSEVAGLSQQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |