Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0650000_circ_g.4 |
ID in PlantcircBase | osa_circ_025672 |
Alias | Os_ciR2426 |
Organism | Oryza sativa |
Position | chr4: 33124967-33125432 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os04g0650000 |
Parent gene annotation |
Similar to Oryzain alpha chain precursor (EC 3.4.22.-). (Os04t06 50000-01);Similar to Oryzain alpha chain precursor (EC 3.4.22.-) . (Os04t0650000-02);Similar to cDNA clone:J013002H09, full inser t sequence. (Os04t0650000-03) |
Parent gene strand | - |
Alternative splicing | Os04g0650000_circ_g.5 |
Support reads | 4/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0650000-03:1 Os04t0650000-02:2 Os04t0650000-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005797* osi_circ_014941 zma_circ_010377* |
PMCS | 0.40915068 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33125391-33125013(+) 33125297-33125408(-) |
Potential amino acid sequence |
MPSTAAIAEKAQQLPMSRAGMLCHRLQLQH*(+) MDYAFDFIINNGGIDTEDDYPYKGKDERCDVNRKNAKVVTIDSYEDVTPNSETSLQKAVANQPV SVAIEAGGRAFQLYSSEVAGLSQQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |