Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA014213_circ_g.3 |
| ID in PlantcircBase | osi_circ_005797 |
| Alias | 4:32130168|32130633 |
| Organism | Oryza sativa ssp. indica |
| Position | chr4: 32130168-32130633 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA014213 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA014213_circ_g.1 BGIOSGA014213_circ_g.2 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA014213-TA:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_025672* zma_circ_010377* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32130498-32130609(-) 32130592-32130214(+) |
| Potential amino acid sequence |
MDYAFDFIINNGGIDTEDDYPYKGKDERCDVNRKNAKVVTIDSYEDVTPNSETSLQKAVANQPV SVAIEAGGRAFQLYSSEVAGLSQQ*(-) MPSTAAIAEKAQQLPMSRAGMLCHRLQLQH*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |