Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0466700_circ_g.2 |
ID in PlantcircBase | osa_circ_024125 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 23319542-23320329 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0466700 |
Parent gene annotation |
Armadillo-type fold domain containing protein. (Os04t0466700-01) |
Parent gene strand | - |
Alternative splicing | Os04g0466700_circ_g.1 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0466700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.187833238 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23319546-23319563(-) |
Potential amino acid sequence |
MDLSKTIELGFQSDRTRLFQYFIKPCIIIFCQNEKVLCCALEMLKSFATGDDHVLSSASKLNYP GELSHRICVVTTILIFLCNDGKLHKNLSLGKCVIKGILQHTRHLMDSNVLDVTYEDKQKLRFAF EQLKTKALQLNCWDRSELEGFSSTT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |