Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0466700_circ_g.1 |
| ID in PlantcircBase | osa_circ_024124 |
| Alias | Os_ciR9383 |
| Organism | Oryza sativa |
| Position | chr4: 23319272-23320329 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0466700 |
| Parent gene annotation |
Armadillo-type fold domain containing protein. (Os04t0466700-01) |
| Parent gene strand | - |
| Alternative splicing | Os04g0466700_circ_g.2 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0466700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005543* |
| PMCS | 0.165575725 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23319372-23319563(-) |
| Potential amino acid sequence |
MVTGEGQKDMCHPTCVRLQYTPLLFSCYQHFTKDLSKTIELGFQSDRTRLFQYFIKPCIIIFCQ NEKVLCCALEMLKSFATGDDHVLSSASKLNYPGELSHRICVVTTILIFLCNDGKLHKNLSLGKC VIKGILQHTRHLMDSNVLDVTYEDKQKLRFAFEQLKTKALQLNCWDRSELEGFSSTT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |