Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0546300_circ_g.3 |
| ID in PlantcircBase | osa_circ_007896 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 21351486-21352457 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0546300 |
| Parent gene annotation |
Protein of unknown function DUF2451, C-terminal domain containin g protein. (Os10t0546300-01) |
| Parent gene strand | + |
| Alternative splicing | Os10g0546300_circ_g.2 Os10g0546300_circ_g.4 Os10g0546300_circ_g.5 Os10g0546300_circ_g.6 Os10g0546300_circ_g.7 Os10g0546300_circ_g.8 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0546300-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.153747402 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21352028-21351675(+) 21352071-21352044(-) |
| Potential amino acid sequence |
MFFQFLQNFVMHKTCRWNLKVLWRKKTIFRRFNYCLNICKSWRTIQAFLLYKKWGVGLSEGDAV SDGVRTRFKGCKCDLHEWTEACILFKE*(+) MSCALRSSVRIGRTSSKACFFFDFTLTTRSLDTSFFEEDTCLRPFMQITFATFKSCSNSITNCI PFTQSHAPFLVQKKGLNSSPRFANIQAIIETPENSFLSPQNFQVPSACLVHYEVL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |