Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d006382_circ_g.12 |
| ID in PlantcircBase | zma_circ_007357 |
| Alias | zma_circ_0000901 |
| Organism | Zea mays |
| Position | chr2: 206205455-206205687 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d006382 |
| Parent gene annotation |
DNA mismatch repair protein MSH4 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d006382_circ_g.1 Zm00001d006382_circ_g.2 Zm00001d006382_circ_g.3 Zm00001d006382_circ_g.4 Zm00001d006382_circ_g.5 Zm00001d006382_circ_g.6 Zm00001d006382_circ_g.7 Zm00001d006382_circ_g.8 Zm00001d006382_circ_g.9 Zm00001d006382_circ_g.10 Zm00001d006382_circ_g.11 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d006382_T002:2 Zm00001d006382_T005:2 Zm00001d006382_T006:2 Zm00001d006382_T003:2 Zm00001d006382_T010:2 Zm00001d006382_T004:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.157367382 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
206205459-206205458(+) 206205491-206205488(-) |
| Potential amino acid sequence |
MTEMKETAFIMQNVSSRSLVVVDELGRATSSSDGLAIAWSCCEYLLSVKAL*(+) MMKAVSFISVIKLSQKEGIHSNSMRLPTHLRKMLLFQVHPQQPNSLKKHFA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |