Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_11G035800_circ_g.1 |
| ID in PlantcircBase | gma_circ_002911 |
| Alias | Gm11circRNA1134 |
| Organism | Glycine max |
| Position | chr11: 2577854-2579029 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat, CIRI |
| Parent gene | GLYMA_11G035800 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_11G035800_circ_g.2 |
| Support reads | NA |
| Tissues | root, stem |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH28154:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.509735247 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2578929-2577892(+) 2579026-2579014(-) |
| Potential amino acid sequence |
MTPKCLAHSICPSSIMKISEVNSISLSSLKCPYHNGLFCNHHIRASM*(+) MDILGLKERLSLLLKFSLYLKGISNVLDILESSFKGTLSAQLHDLQNLQESIMKTKQHMDVIIW CTRHQFLEGVRSRFTDGSSWSSVVRIRKSEAIRRAWPDAINQSVESQGHDGSLFIEDALNNLDL EEGFRNEIVEGLEIASLQKDSASFLGSNTDQMLGYYPFKNLRSAVDLLFLHGGSDMVVAKQAIM IWTF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |