Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0448400_circ_g.3 |
ID in PlantcircBase | osa_circ_014564 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 14535643-14536109 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0448400 |
Parent gene annotation |
Similar to Synaptotagmin C. (Os02t0448400-01) |
Parent gene strand | - |
Alternative splicing | Os02g0448400_circ_g.1 Os02g0448400_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0448500-00:2 Os02t0448400-01:3 Os02t0448500-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.163991113 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14536058-14535658(+) 14536060-14536086(-) |
Potential amino acid sequence |
MLSRDFVSSSTSGLITGSLKCWW*(+) MLPEVPHWVKNPDFDRIDWLNKFVENIWPYLDKAICKTAKEIAKPIIAENTAKYKIDSVEFETL TLGSLPPTFQGPCNQATC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |