Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0448400_circ_g.3 |
| ID in PlantcircBase | osa_circ_014564 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 14535643-14536109 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0448400 |
| Parent gene annotation |
Similar to Synaptotagmin C. (Os02t0448400-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0448400_circ_g.1 Os02g0448400_circ_g.2 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0448500-00:2 Os02t0448400-01:3 Os02t0448500-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.163991113 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14536058-14535658(+) 14536060-14536086(-) |
| Potential amino acid sequence |
MLSRDFVSSSTSGLITGSLKCWW*(+) MLPEVPHWVKNPDFDRIDWLNKFVENIWPYLDKAICKTAKEIAKPIIAENTAKYKIDSVEFETL TLGSLPPTFQGPCNQATC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |