Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0645100_circ_g.6 |
ID in PlantcircBase | osa_circ_025604 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 32836781-32836853 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os04g0645100 |
Parent gene annotation |
Tetratricopeptide repeat (TPR) domain containing protein, Grain size and starch quality (Os04t0645100-01);Similar to H0811D08.1 protein. (Os04t0645100-02) |
Parent gene strand | + |
Alternative splicing | Os04g0645100_circ_g.2 Os04g0645100_circ_g.3 Os04g0645100_circ_g.4 Os04g0645100_circ_g.5 |
Support reads | 1 |
Tissues | pistil |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0645100-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.243153995 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32836832-32836823(+) 32836834-32836841(-) 32836847-32836841(-) |
Potential amino acid sequence |
MLSHHRGRREGSGWRTAWKSCR*(+) MVSATRFPRRPPAAALASSTMVREHGFSDTISTPSSSRCPRVFHDGERAWFQRHDFHAVLQPLP SRLPRW*(-) MVREHGFSDTISTPSSSRCPRVFHDGERAWFQRHDFHAVLQPLPSRLPRW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |