Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0645100_circ_g.6 |
| ID in PlantcircBase | osa_circ_025604 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 32836781-32836853 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os04g0645100 |
| Parent gene annotation |
Tetratricopeptide repeat (TPR) domain containing protein, Grain size and starch quality (Os04t0645100-01);Similar to H0811D08.1 protein. (Os04t0645100-02) |
| Parent gene strand | + |
| Alternative splicing | Os04g0645100_circ_g.2 Os04g0645100_circ_g.3 Os04g0645100_circ_g.4 Os04g0645100_circ_g.5 |
| Support reads | 1 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0645100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.243153995 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32836832-32836823(+) 32836834-32836841(-) 32836847-32836841(-) |
| Potential amino acid sequence |
MLSHHRGRREGSGWRTAWKSCR*(+) MVSATRFPRRPPAAALASSTMVREHGFSDTISTPSSSRCPRVFHDGERAWFQRHDFHAVLQPLP SRLPRW*(-) MVREHGFSDTISTPSSSRCPRVFHDGERAWFQRHDFHAVLQPLPSRLPRW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |